Entry PED2AAA: Unbound p27 KID domain

Entry summary

Random pool MD SAXS NMR Validated

Authors: Sivashankar G. Sivakolundu; Donald Bashford; Richard W. Kriwacki

Publication: Disordered p27Kip1 Exhibits Intrinsic Structure Resembling the Cdk2/Cyclin A-bound Conformation

Release date: 2014-01-16

Abstract:

p27Kip1 (p27) influences cell division by regulating nuclear cyclin- dependent kinases. Before binding, p27 is at least partially disordered and folds upon binding its Cdk/cyclin targets. 30-40% of human proteins, including p27, are predicted to contain disordered segments, and have been termed intrinsically unstructured proteins (IUPs). Unfortunately, the inherent dynamics of IUPs hamper detailed analysis of their structure/ function relationships. Here, we describe the use of molecular dynamics (MD) computations and solution NMR spectroscopy to reveal that several segments of the p27 kinase inhibitory domain (p27-KID), in addition to the previously characterized helical segment, exist as highly populated, intrinsically folded structural units (IFSUs). Several IFSUs resemble structural features of bound p27-KID, while another exhibits alternative conformations. Interestingly, the highly conserved, specificity determining segment of p27 is shown to be highly disordered. Elucidation of IFSUs within p27-KID allows consideration of their influences on the thermo- dynamics and kinetics of Cdk/cyclin binding. The degree to which IFSUs are populated within p27-KID is surprising and suggests that other putative IUPs contain IFSUs that may be studied using similar techniques.

Sample images

Click on any of the images to open JSmol

Most compact conformation

Average conformation

Most extended conformation

Download PDB files

Protein information

p27 Kip1

Biological function: Cyclin-dependent protein serine/threonine kinase inhibitor activity [ref]

Protein name: p27 Kip1
UniProt link: O43806
Organism: Homo sapiens
Expressed in: Escherichia coli BL21 (DE3)
Number of residues: 69
Theoretic molecular weight: 8370.3
Theoretic isoelectric point: 5.16
Sequence range (relative to UniProt): 25-93
Post-translational modifications: No
Mutations: No


Amino acid sequence:

KPSACRNLFGPVDDEELTRDLEKKCRDMEEASQRKWNFDFQNNKPLEGKYEWQEVEKGSLPEFYYRPPR

Download sequence in FASTA format